Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017915-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: COL15A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028339: 35%, ENSRNOG00000060381: 33%
Entrez Gene ID: 1306
Uniprot ID: P39059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA |
| Gene Sequence | MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA |
| Gene ID - Mouse | ENSMUSG00000028339 |
| Gene ID - Rat | ENSRNOG00000060381 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) | |
| Datasheet | Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) | |
| Datasheet | Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) |
| Citations for Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) – 1 Found |
| Adams, Taylor S; Schupp, Jonas C; Poli, Sergio; Ayaub, Ehab A; Neumark, Nir; Ahangari, Farida; Chu, Sarah G; Raby, Benjamin A; DeIuliis, Giuseppe; Januszyk, Michael; Duan, Qiaonan; Arnett, Heather A; Siddiqui, Asim; Washko, George R; Homer, Robert; Yan, Xiting; Rosas, Ivan O; Kaminski, Naftali. Single-cell RNA-seq reveals ectopic and aberrant lung-resident cell populations in idiopathic pulmonary fibrosis. Science Advances. 2020;6(28):eaba1983. PubMed |