Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017915-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $303.00
    
         
                            Gene Name: COL15A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028339: 35%, ENSRNOG00000060381: 33%
Entrez Gene ID: 1306
Uniprot ID: P39059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA | 
| Gene Sequence | MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA | 
| Gene ID - Mouse | ENSMUSG00000028339 | 
| Gene ID - Rat | ENSRNOG00000060381 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) | |
| Datasheet | Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) at Atlas Antibodies | 
| Documents & Links for Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) | |
| Datasheet | Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) | 
| Citations for Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) – 1 Found | 
| Adams, Taylor S; Schupp, Jonas C; Poli, Sergio; Ayaub, Ehab A; Neumark, Nir; Ahangari, Farida; Chu, Sarah G; Raby, Benjamin A; DeIuliis, Giuseppe; Januszyk, Michael; Duan, Qiaonan; Arnett, Heather A; Siddiqui, Asim; Washko, George R; Homer, Robert; Yan, Xiting; Rosas, Ivan O; Kaminski, Naftali. Single-cell RNA-seq reveals ectopic and aberrant lung-resident cell populations in idiopathic pulmonary fibrosis. Science Advances. 2020;6(28):eaba1983. PubMed | 
 
         
                            