Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017915-25

• 

Protein Description: collagen, type XV, alpha 1
Gene Name: COL15A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028339: 35%, ENSRNOG00000060381: 33%
Entrez Gene ID: 1306
Uniprot ID: P39059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA
• Gene Sequence: MPGEVEASGVAPGELDLSMSAQSLGEEATVGPSSEDSLTTAAAATEVSLSTFEDEEASGVPTDGLAPLTATMAPERAVTSGPGDEEDLAAA
• Gene ID - Mouse: ENSMUSG00000028339
• Gene ID - Rat: ENSRNOG00000060381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COL15A1 pAb (ATL-HPA017915 w/enhanced validation) – 1 Found

Adams, Taylor S; Schupp, Jonas C; Poli, Sergio; Ayaub, Ehab A; Neumark, Nir; Ahangari, Farida; Chu, Sarah G; Raby, Benjamin A; DeIuliis, Giuseppe; Januszyk, Michael; Duan, Qiaonan; Arnett, Heather A; Siddiqui, Asim; Washko, George R; Homer, Robert; Yan, Xiting; Rosas, Ivan O; Kaminski, Naftali. Single-cell RNA-seq reveals ectopic and aberrant lung-resident cell populations in idiopathic pulmonary fibrosis. Science Advances. 2020;6(28):eaba1983.