Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017913-25

• 
• 

Protein Description: collagen, type XV, alpha 1
Gene Name: COL15A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028339: 76%, ENSRNOG00000060381: 77%
Entrez Gene ID: 1306
Uniprot ID: P39059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEESSASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPE
• Gene Sequence: RSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEESSASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPE
• Gene ID - Mouse: ENSMUSG00000028339
• Gene ID - Rat: ENSRNOG00000060381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation) – 3 Found

El Mourabit, Haquima; Loeuillard, Emilien; Lemoinne, Sara; Cadoret, Axelle; Housset, Chantal. Culture Model of Rat Portal Myofibroblasts. Frontiers In Physiology. 7( 27065888):120. 

Durgin, Brittany G; Cherepanova, Olga A; Gomez, Delphine; Karaoli, Themistoclis; Alencar, Gabriel F; Butcher, Joshua T; Zhou, Yu-Qing; Bendeck, Michelle P; Isakson, Brant E; Owens, Gary K; Connelly, Jessica J. Smooth muscle cell-specific deletion of Col15a1 unexpectedly leads to impaired development of advanced atherosclerotic lesions. American Journal Of Physiology. Heart And Circulatory Physiology. 2017;312(5):H943-H958. 

Zhang, Zhiqiao; Li, Jing; He, Tingshan; Ouyang, Yanling; Huang, Yiyan; Liu, Qingbo; Wang, Peng; Ding, Jianqiang. Two predictive precision medicine tools for hepatocellular carcinoma. Cancer Cell International. 19( 31754347):290.