Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA017913-25
- Shipping:
- Calculated at Checkout
        
            
        
        
        $395.00
    
         
                            Gene Name: COL15A1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028339: 76%, ENSRNOG00000060381: 77%
Entrez Gene ID: 1306
Uniprot ID: P39059
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC | 
| Reactivity | Human | 
| Clonality | Polyclonal | 
| Host | Rabbit | 
| Immunogen | RSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEESSASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPE | 
| Gene Sequence | RSSQALAFESSAGIFMGNAGATGLERFTGSLQQLTVHPDPRTPEELCDPEESSASGETSGLQEADGVAEILEAVTYTQASPKEAKVEPINTPPTPSSPFEDMELSGEPVPE | 
| Gene ID - Mouse | ENSMUSG00000028339 | 
| Gene ID - Rat | ENSRNOG00000060381 | 
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. | 
| Documents & Links for Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation) | |
| Datasheet | Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation) at Atlas Antibodies | 
| Documents & Links for Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation) | |
| Datasheet | Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation) Datasheet (External Link) | 
| Vendor Page | Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation) | 
| Citations for Anti COL15A1 pAb (ATL-HPA017913 w/enhanced validation) – 3 Found | 
| El Mourabit, Haquima; Loeuillard, Emilien; Lemoinne, Sara; Cadoret, Axelle; Housset, Chantal. Culture Model of Rat Portal Myofibroblasts. Frontiers In Physiology. 7( 27065888):120. PubMed | 
| Durgin, Brittany G; Cherepanova, Olga A; Gomez, Delphine; Karaoli, Themistoclis; Alencar, Gabriel F; Butcher, Joshua T; Zhou, Yu-Qing; Bendeck, Michelle P; Isakson, Brant E; Owens, Gary K; Connelly, Jessica J. Smooth muscle cell-specific deletion of Col15a1 unexpectedly leads to impaired development of advanced atherosclerotic lesions. American Journal Of Physiology. Heart And Circulatory Physiology. 2017;312(5):H943-H958. PubMed | 
| Zhang, Zhiqiao; Li, Jing; He, Tingshan; Ouyang, Yanling; Huang, Yiyan; Liu, Qingbo; Wang, Peng; Ding, Jianqiang. Two predictive precision medicine tools for hepatocellular carcinoma. Cancer Cell International. 19( 31754347):290. PubMed | 
 
         
                             
                                        