Anti COL14A1 pAb (ATL-HPA023781)

Atlas Antibodies

Catalog No.:
ATL-HPA023781-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: collagen, type XIV, alpha 1
Gene Name: COL14A1
Alternative Gene Name: UND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022371: 87%, ENSRNOG00000026415: 87%
Entrez Gene ID: 7373
Uniprot ID: Q05707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDLEKRKDPKPR
Gene Sequence LLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDLEKRKDPKPR
Gene ID - Mouse ENSMUSG00000022371
Gene ID - Rat ENSRNOG00000026415
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COL14A1 pAb (ATL-HPA023781)
Datasheet Anti COL14A1 pAb (ATL-HPA023781) Datasheet (External Link)
Vendor Page Anti COL14A1 pAb (ATL-HPA023781) at Atlas Antibodies

Documents & Links for Anti COL14A1 pAb (ATL-HPA023781)
Datasheet Anti COL14A1 pAb (ATL-HPA023781) Datasheet (External Link)
Vendor Page Anti COL14A1 pAb (ATL-HPA023781)