Anti COL14A1 pAb (ATL-HPA023781)

Atlas Antibodies

SKU: ATL-HPA023781-100

• 
• 
• 

Protein Description: collagen, type XIV, alpha 1
Gene Name: COL14A1
Alternative Gene Name: UND
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022371: 87%, ENSRNOG00000026415: 87%
Entrez Gene ID: 7373
Uniprot ID: Q05707
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDLEKRKDPKPR
• Gene Sequence: LLVTPTSGGKTNQLNLQNTATKAIIQGLMPDQNYTVQIIAYNKDKESKPAQGQFRIKDLEKRKDPKPR
• Gene ID - Mouse: ENSMUSG00000022371
• Gene ID - Rat: ENSRNOG00000026415
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.