Anti COL12A1 pAb (ATL-HPA009143)

Atlas Antibodies

Catalog No.:
ATL-HPA009143-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: collagen, type XII, alpha 1
Gene Name: COL12A1
Alternative Gene Name: COL12A1L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032332: 86%, ENSRNOG00000058470: 86%
Entrez Gene ID: 1303
Uniprot ID: Q99715
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG
Gene Sequence VTTPPNQRRRTLENLIPDTKYEVSVIPEYFSGPGTPLTGNAATEEVRGNPRDLRVSDPTTSTMKLSWSGAPGKVKQYLVTYTPVAGGETQEVTVRGDTTNTVLQGLKEGTQYALSVTALYASGAG
Gene ID - Mouse ENSMUSG00000032332
Gene ID - Rat ENSRNOG00000058470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COL12A1 pAb (ATL-HPA009143)
Datasheet Anti COL12A1 pAb (ATL-HPA009143) Datasheet (External Link)
Vendor Page Anti COL12A1 pAb (ATL-HPA009143) at Atlas Antibodies

Documents & Links for Anti COL12A1 pAb (ATL-HPA009143)
Datasheet Anti COL12A1 pAb (ATL-HPA009143) Datasheet (External Link)
Vendor Page Anti COL12A1 pAb (ATL-HPA009143)
Citations for Anti COL12A1 pAb (ATL-HPA009143) – 2 Found
Thant, Lay; Kaku, Masaru; Kakihara, Yoshito; Mizukoshi, Masaru; Kitami, Megumi; Arai, Moe; Kitami, Kohei; Kobayashi, Daiki; Yoshida, Yutaka; Maeda, Takeyasu; Saito, Isao; Uoshima, Katsumi; Saeki, Makio. Extracellular Matrix-Oriented Proteomic Analysis of Periodontal Ligament Under Mechanical Stress. Frontiers In Physiology. 13( 35669581):899699.  PubMed
Tang, Zengwei; Yang, Yuan; Zhang, Qi; Liang, Tingbo. Epigenetic dysregulation-mediated COL12A1 upregulation predicts worse outcome in intrahepatic cholangiocarcinoma patients. Clinical Epigenetics. 2023;15(1):13.  PubMed