Anti COL11A1 pAb (ATL-HPA058335)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058335-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: COL11A1
Alternative Gene Name: CO11A1, COLL6, STL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027966: 85%, ENSRNOG00000023148: 86%
Entrez Gene ID: 1301
Uniprot ID: P12107
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG |
| Gene Sequence | DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG |
| Gene ID - Mouse | ENSMUSG00000027966 |
| Gene ID - Rat | ENSRNOG00000023148 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COL11A1 pAb (ATL-HPA058335) | |
| Datasheet | Anti COL11A1 pAb (ATL-HPA058335) Datasheet (External Link) |
| Vendor Page | Anti COL11A1 pAb (ATL-HPA058335) at Atlas Antibodies |
| Documents & Links for Anti COL11A1 pAb (ATL-HPA058335) | |
| Datasheet | Anti COL11A1 pAb (ATL-HPA058335) Datasheet (External Link) |
| Vendor Page | Anti COL11A1 pAb (ATL-HPA058335) |