Anti COL11A1 pAb (ATL-HPA058335)

Atlas Antibodies

Catalog No.:
ATL-HPA058335-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: collagen, type XI, alpha 1
Gene Name: COL11A1
Alternative Gene Name: CO11A1, COLL6, STL2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027966: 85%, ENSRNOG00000023148: 86%
Entrez Gene ID: 1301
Uniprot ID: P12107
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG
Gene Sequence DCDSSAPKAAQAQEPQIDEYAPEDIIEYDYEYGEAEYKEAESVTEGPTVTEETIAQTEANIVDDFQEYNYG
Gene ID - Mouse ENSMUSG00000027966
Gene ID - Rat ENSRNOG00000023148
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COL11A1 pAb (ATL-HPA058335)
Datasheet Anti COL11A1 pAb (ATL-HPA058335) Datasheet (External Link)
Vendor Page Anti COL11A1 pAb (ATL-HPA058335) at Atlas Antibodies

Documents & Links for Anti COL11A1 pAb (ATL-HPA058335)
Datasheet Anti COL11A1 pAb (ATL-HPA058335) Datasheet (External Link)
Vendor Page Anti COL11A1 pAb (ATL-HPA058335)