Anti COIL pAb (ATL-HPA068537)

Atlas Antibodies

Catalog No.:
ATL-HPA068537-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: coilin
Gene Name: COIL
Alternative Gene Name: CLN80, p80-coilin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033983: 81%, ENSRNOG00000000244: 79%
Entrez Gene ID: 8161
Uniprot ID: P38432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDC
Gene Sequence ASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDC
Gene ID - Mouse ENSMUSG00000033983
Gene ID - Rat ENSRNOG00000000244
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COIL pAb (ATL-HPA068537)
Datasheet Anti COIL pAb (ATL-HPA068537) Datasheet (External Link)
Vendor Page Anti COIL pAb (ATL-HPA068537) at Atlas Antibodies

Documents & Links for Anti COIL pAb (ATL-HPA068537)
Datasheet Anti COIL pAb (ATL-HPA068537) Datasheet (External Link)
Vendor Page Anti COIL pAb (ATL-HPA068537)