Anti COIL pAb (ATL-HPA068537)
Atlas Antibodies
- Catalog No.:
- ATL-HPA068537-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: COIL
Alternative Gene Name: CLN80, p80-coilin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033983: 81%, ENSRNOG00000000244: 79%
Entrez Gene ID: 8161
Uniprot ID: P38432
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDC |
| Gene Sequence | ASETVRLRLQFDYPPPATPHCTAFWLLVDLNRCRVVTDLISLIRQRFGFSSGAFLGLYLEGGLLPPAESARLVRDNDCLRVKLEERGVAENSVVISNGDINLSLRKAKKRAFQLEEGEETEPDC |
| Gene ID - Mouse | ENSMUSG00000033983 |
| Gene ID - Rat | ENSRNOG00000000244 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COIL pAb (ATL-HPA068537) | |
| Datasheet | Anti COIL pAb (ATL-HPA068537) Datasheet (External Link) |
| Vendor Page | Anti COIL pAb (ATL-HPA068537) at Atlas Antibodies |
| Documents & Links for Anti COIL pAb (ATL-HPA068537) | |
| Datasheet | Anti COIL pAb (ATL-HPA068537) Datasheet (External Link) |
| Vendor Page | Anti COIL pAb (ATL-HPA068537) |