Anti COG8 pAb (ATL-HPA049429)

Atlas Antibodies

Catalog No.: ATL-HPA049429-25

Protein Description: component of oligomeric golgi complex 8
Gene Name: COG8
Alternative Gene Name: DOR1, FLJ22315
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031916: 89%, ENSRNOG00000020379: 89%
Entrez Gene ID: 84342
Uniprot ID: Q96MW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPL
• Gene Sequence: AKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPL
• Gene ID - Mouse: ENSMUSG00000031916
• Gene ID - Rat: ENSRNOG00000020379
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.