Anti COG8 pAb (ATL-HPA049429)

Atlas Antibodies

Catalog No.:
ATL-HPA049429-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 8
Gene Name: COG8
Alternative Gene Name: DOR1, FLJ22315
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031916: 89%, ENSRNOG00000020379: 89%
Entrez Gene ID: 84342
Uniprot ID: Q96MW5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPL
Gene Sequence AKVTKIILAFHRAEEAAFSSGEQELFVQFCTVFLEDLVPYLNRCLQVLFPPAQIAQTLGIPPTQLSKYGNLGHVNIGAIQEPL
Gene ID - Mouse ENSMUSG00000031916
Gene ID - Rat ENSRNOG00000020379
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COG8 pAb (ATL-HPA049429)
Datasheet Anti COG8 pAb (ATL-HPA049429) Datasheet (External Link)
Vendor Page Anti COG8 pAb (ATL-HPA049429) at Atlas Antibodies

Documents & Links for Anti COG8 pAb (ATL-HPA049429)
Datasheet Anti COG8 pAb (ATL-HPA049429) Datasheet (External Link)
Vendor Page Anti COG8 pAb (ATL-HPA049429)