Anti COG7 pAb (ATL-HPA064645)

Atlas Antibodies

SKU:
ATL-HPA064645-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to the Golgi apparatus.
  • Western blot analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 7
Gene Name: COG7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034951: 88%, ENSRNOG00000060008: 88%
Entrez Gene ID: 91949
Uniprot ID: P83436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVN
Gene Sequence LPELDNMADNWLGSIARATMQTYCDAILQIPELSPHSAKQLATDIDYLINVMDALGLQPSRTLQHIVTLLKTRPEDYRQVSKGLPRRLATTVATMRSVN
Gene ID - Mouse ENSMUSG00000034951
Gene ID - Rat ENSRNOG00000060008
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COG7 pAb (ATL-HPA064645)
Datasheet Anti COG7 pAb (ATL-HPA064645) Datasheet (External Link)
Vendor Page Anti COG7 pAb (ATL-HPA064645) at Atlas Antibodies

Documents & Links for Anti COG7 pAb (ATL-HPA064645)
Datasheet Anti COG7 pAb (ATL-HPA064645) Datasheet (External Link)
Vendor Page Anti COG7 pAb (ATL-HPA064645)