Anti COG7 pAb (ATL-HPA041824)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041824-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: COG7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034951: 92%, ENSRNOG00000060008: 90%
Entrez Gene ID: 91949
Uniprot ID: P83436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GFQESILTDKKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKMDSWNTAGIG |
Gene Sequence | GFQESILTDKKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKMDSWNTAGIG |
Gene ID - Mouse | ENSMUSG00000034951 |
Gene ID - Rat | ENSRNOG00000060008 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti COG7 pAb (ATL-HPA041824) | |
Datasheet | Anti COG7 pAb (ATL-HPA041824) Datasheet (External Link) |
Vendor Page | Anti COG7 pAb (ATL-HPA041824) at Atlas Antibodies |
Documents & Links for Anti COG7 pAb (ATL-HPA041824) | |
Datasheet | Anti COG7 pAb (ATL-HPA041824) Datasheet (External Link) |
Vendor Page | Anti COG7 pAb (ATL-HPA041824) |