Anti COG7 pAb (ATL-HPA041824)

Atlas Antibodies

Catalog No.:
ATL-HPA041824-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 7
Gene Name: COG7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034951: 92%, ENSRNOG00000060008: 90%
Entrez Gene ID: 91949
Uniprot ID: P83436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GFQESILTDKKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKMDSWNTAGIG
Gene Sequence GFQESILTDKKNSAKNPWQEYNYLQKDNPAEYASLMEILYTLKEKGSSNHNLLAAPRAALTRLNQQAHQLAFDSVFLRIKQQLLLISKMDSWNTAGIG
Gene ID - Mouse ENSMUSG00000034951
Gene ID - Rat ENSRNOG00000060008
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COG7 pAb (ATL-HPA041824)
Datasheet Anti COG7 pAb (ATL-HPA041824) Datasheet (External Link)
Vendor Page Anti COG7 pAb (ATL-HPA041824) at Atlas Antibodies

Documents & Links for Anti COG7 pAb (ATL-HPA041824)
Datasheet Anti COG7 pAb (ATL-HPA041824) Datasheet (External Link)
Vendor Page Anti COG7 pAb (ATL-HPA041824)