Anti COG7 pAb (ATL-HPA040758 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA040758-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: COG7
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034951: 96%, ENSRNOG00000060008: 95%
Entrez Gene ID: 91949
Uniprot ID: P83436
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQAVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQ |
| Gene Sequence | ISAKLTGMQNSLMMLVDTPDYSEKCVHLEALKNRLEALASPQIVAAFTSQAVDQSKVFVKVFTEIDRMPQLLAYYYKCHKVQLLAAWQELCQSDLSLDRQ |
| Gene ID - Mouse | ENSMUSG00000034951 |
| Gene ID - Rat | ENSRNOG00000060008 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COG7 pAb (ATL-HPA040758 w/enhanced validation) | |
| Datasheet | Anti COG7 pAb (ATL-HPA040758 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COG7 pAb (ATL-HPA040758 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COG7 pAb (ATL-HPA040758 w/enhanced validation) | |
| Datasheet | Anti COG7 pAb (ATL-HPA040758 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COG7 pAb (ATL-HPA040758 w/enhanced validation) |