Anti COG6 pAb (ATL-HPA040441 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA040441-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 6
Gene Name: COG6
Alternative Gene Name: COD2, KIAA1134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027742: 83%, ENSRNOG00000013660: 84%
Entrez Gene ID: 57511
Uniprot ID: Q9Y2V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VQQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLL
Gene Sequence VQQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLL
Gene ID - Mouse ENSMUSG00000027742
Gene ID - Rat ENSRNOG00000013660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COG6 pAb (ATL-HPA040441 w/enhanced validation)
Datasheet Anti COG6 pAb (ATL-HPA040441 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COG6 pAb (ATL-HPA040441 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti COG6 pAb (ATL-HPA040441 w/enhanced validation)
Datasheet Anti COG6 pAb (ATL-HPA040441 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti COG6 pAb (ATL-HPA040441 w/enhanced validation)