Anti COG6 pAb (ATL-HPA040441 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040441-100

Protein Description: component of oligomeric golgi complex 6
Gene Name: COG6
Alternative Gene Name: COD2, KIAA1134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027742: 83%, ENSRNOG00000013660: 84%
Entrez Gene ID: 57511
Uniprot ID: Q9Y2V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VQQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLL
• Gene Sequence: VQQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAPDNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEVYAAVMNPINEYKDPENILHRSPQQVQTLL
• Gene ID - Mouse: ENSMUSG00000027742
• Gene ID - Rat: ENSRNOG00000013660
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.