Anti COG6 pAb (ATL-HPA040410)

Atlas Antibodies

SKU:
ATL-HPA040410-25
  • Immunohistochemical staining of human colon shows moderate cytoplasmic positivity in glandular cells.
  • Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells)<br/>Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 6
Gene Name: COG6
Alternative Gene Name: COD2, KIAA1134
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027742: 93%, ENSRNOG00000013660: 93%
Entrez Gene ID: 57511
Uniprot ID: Q9Y2V7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen HLEALLKHVTTQGVEENIQEVVGHITEGVCRPLKVRIEQVIVAEPGAVLLYKISNLLKFYHHTISGIVGNSATALLTTIEEMHLLSKKIFFNSLSLHASKL
Gene Sequence HLEALLKHVTTQGVEENIQEVVGHITEGVCRPLKVRIEQVIVAEPGAVLLYKISNLLKFYHHTISGIVGNSATALLTTIEEMHLLSKKIFFNSLSLHASKL
Gene ID - Mouse ENSMUSG00000027742
Gene ID - Rat ENSRNOG00000013660
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COG6 pAb (ATL-HPA040410)
Datasheet Anti COG6 pAb (ATL-HPA040410) Datasheet (External Link)
Vendor Page Anti COG6 pAb (ATL-HPA040410) at Atlas Antibodies

Documents & Links for Anti COG6 pAb (ATL-HPA040410)
Datasheet Anti COG6 pAb (ATL-HPA040410) Datasheet (External Link)
Vendor Page Anti COG6 pAb (ATL-HPA040410)