Anti COG5 pAb (ATL-HPA041583)

Atlas Antibodies

Catalog No.: ATL-HPA041583-25

Protein Description: component of oligomeric golgi complex 5
Gene Name: COG5
Alternative Gene Name: GOLTC1, GTC90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035933: 94%, ENSRNOG00000056610: 93%
Entrez Gene ID: 10466
Uniprot ID: Q9UP83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LAVGPFCRRVSDLGKSYRMLRSFRPLLFQASEHVASSPALGDVIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAMSALQ
• Gene Sequence: LAVGPFCRRVSDLGKSYRMLRSFRPLLFQASEHVASSPALGDVIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAMSALQ
• Gene ID - Mouse: ENSMUSG00000035933
• Gene ID - Rat: ENSRNOG00000056610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.