Anti COG5 pAb (ATL-HPA041583)

Atlas Antibodies

Catalog No.:
ATL-HPA041583-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 5
Gene Name: COG5
Alternative Gene Name: GOLTC1, GTC90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035933: 94%, ENSRNOG00000056610: 93%
Entrez Gene ID: 10466
Uniprot ID: Q9UP83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LAVGPFCRRVSDLGKSYRMLRSFRPLLFQASEHVASSPALGDVIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAMSALQ
Gene Sequence LAVGPFCRRVSDLGKSYRMLRSFRPLLFQASEHVASSPALGDVIPFSIIIQFLFTRAPAELKSPFQRAEWSHTRFSQWLDDHPSEKDRLLLIRGALEAYVQSVRSREGKEFAPVYPIMVQLLQKAMSALQ
Gene ID - Mouse ENSMUSG00000035933
Gene ID - Rat ENSRNOG00000056610
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COG5 pAb (ATL-HPA041583)
Datasheet Anti COG5 pAb (ATL-HPA041583) Datasheet (External Link)
Vendor Page Anti COG5 pAb (ATL-HPA041583) at Atlas Antibodies

Documents & Links for Anti COG5 pAb (ATL-HPA041583)
Datasheet Anti COG5 pAb (ATL-HPA041583) Datasheet (External Link)
Vendor Page Anti COG5 pAb (ATL-HPA041583)