Anti COG5 pAb (ATL-HPA020300)

Atlas Antibodies

SKU: ATL-HPA020300-25

• 
• 

Protein Description: component of oligomeric golgi complex 5
Gene Name: COG5
Alternative Gene Name: GOLTC1, GTC90
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035933: 84%, ENSRNOG00000056610: 84%
Entrez Gene ID: 10466
Uniprot ID: Q9UP83
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVD
• Gene Sequence: SFWTNMEKLMDHIYAVCGQVQHLQKVLAKKRDPVSHICFIEEIVKDGQPEIFYTFWNSVTQALSSQFHMATNSSMFLKQAFEGEYPKLLRLYNDLWKRLQQYSQHIQGNFNASGTTDLYVD
• Gene ID - Mouse: ENSMUSG00000035933
• Gene ID - Rat: ENSRNOG00000056610
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti COG5 pAb (ATL-HPA020300) – 1 Found

Hartwig, Cortnie; Méndez, Gretchen Macías; Bhattacharjee, Shatabdi; Vrailas-Mortimer, Alysia D; Zlatic, Stephanie A; Freeman, Amanda A H; Gokhale, Avanti; Concilli, Mafalda; Werner, Erica; Sapp Savas, Christie; Rudin-Rush, Samantha; Palmer, Laura; Shearing, Nicole; Margewich, Lindsey; McArthy, Jacob; Taylor, Savanah; Roberts, Blaine; Lupashin, Vladimir; Polishchuk, Roman S; Cox, Daniel N; Jorquera, Ramon A; Faundez, Victor. Golgi-Dependent Copper Homeostasis Sustains Synaptic Development and Mitochondrial Content. The Journal Of Neuroscience : The Official Journal Of The Society For Neuroscience. 2021;41(2):215-233.