Anti COG4 pAb (ATL-HPA040924)

Atlas Antibodies

SKU:
ATL-HPA040924-25
  • Immunohistochemical staining of human small intestine shows strong cytoplasmic and membranous positivity in glandular cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 4
Gene Name: COG4
Alternative Gene Name: COD1, DKFZP586E1519
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031753: 99%, ENSRNOG00000017745: 99%
Entrez Gene ID: 25839
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ILDLKFCMDGVQTALRSEDYEQAAAHIHRYLCLDKSVIELSRQGKEGSMIDANLKLLQEAEQRLKAIVAEKFAIATKEGDLPQVERFFKIFPLL
Gene Sequence ILDLKFCMDGVQTALRSEDYEQAAAHIHRYLCLDKSVIELSRQGKEGSMIDANLKLLQEAEQRLKAIVAEKFAIATKEGDLPQVERFFKIFPLL
Gene ID - Mouse ENSMUSG00000031753
Gene ID - Rat ENSRNOG00000017745
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COG4 pAb (ATL-HPA040924)
Datasheet Anti COG4 pAb (ATL-HPA040924) Datasheet (External Link)
Vendor Page Anti COG4 pAb (ATL-HPA040924) at Atlas Antibodies

Documents & Links for Anti COG4 pAb (ATL-HPA040924)
Datasheet Anti COG4 pAb (ATL-HPA040924) Datasheet (External Link)
Vendor Page Anti COG4 pAb (ATL-HPA040924)