Anti COG3 pAb (ATL-HPA054470)

Atlas Antibodies

SKU:
ATL-HPA054470-25
  • Immunofluorescent staining of human cell line Hep G2 shows localization to the Golgi apparatus.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 3
Gene Name: COG3
Alternative Gene Name: SEC34
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034893: 100%, ENSRNOG00000000155: 100%
Entrez Gene ID: 83548
Uniprot ID: Q96JB2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT
Gene Sequence DGQLFLIKHLLILREQIAPFHTEFTIKEISLDLKKTRDAAFKILNPMTVPRFFRLNSNNALIEFLLEGTPEIREHYLDSKKDVDRHLKSACEQFIQQQT
Gene ID - Mouse ENSMUSG00000034893
Gene ID - Rat ENSRNOG00000000155
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COG3 pAb (ATL-HPA054470)
Datasheet Anti COG3 pAb (ATL-HPA054470) Datasheet (External Link)
Vendor Page Anti COG3 pAb (ATL-HPA054470) at Atlas Antibodies

Documents & Links for Anti COG3 pAb (ATL-HPA054470)
Datasheet Anti COG3 pAb (ATL-HPA054470) Datasheet (External Link)
Vendor Page Anti COG3 pAb (ATL-HPA054470)