Anti COG2 pAb (ATL-HPA076994)

Atlas Antibodies

Catalog No.:
ATL-HPA076994-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 2
Gene Name: COG2
Alternative Gene Name: LDLC
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031979: 75%, ENSRNOG00000018228: 74%
Entrez Gene ID: 22796
Uniprot ID: Q14746
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD
Gene Sequence VPTTASSYVDSALKPLFQLQSGHKDKLKQAIIQQWLEGTLSESTHKYYETVSDVLNSVKKMEESLKRLKQARKTTPANPVGPSGGMSDDD
Gene ID - Mouse ENSMUSG00000031979
Gene ID - Rat ENSRNOG00000018228
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COG2 pAb (ATL-HPA076994)
Datasheet Anti COG2 pAb (ATL-HPA076994) Datasheet (External Link)
Vendor Page Anti COG2 pAb (ATL-HPA076994) at Atlas Antibodies

Documents & Links for Anti COG2 pAb (ATL-HPA076994)
Datasheet Anti COG2 pAb (ATL-HPA076994) Datasheet (External Link)
Vendor Page Anti COG2 pAb (ATL-HPA076994)