Anti COG1 pAb (ATL-HPA029224)

Atlas Antibodies

Catalog No.:
ATL-HPA029224-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: component of oligomeric golgi complex 1
Gene Name: COG1
Alternative Gene Name: KIAA1381, LDLB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018661: 75%, ENSRNOG00000002795: 76%
Entrez Gene ID: 9382
Uniprot ID: Q8WTW3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FCSALDSKLKVKLDDLLAYLPSDDSSLPKDVSPTQAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQDALNSAKLHSVLFMA
Gene Sequence FCSALDSKLKVKLDDLLAYLPSDDSSLPKDVSPTQAKSSAFDRYADAGTVQEMLRTQSVACIKHIVDCIRAELQSIEEGVQGQQDALNSAKLHSVLFMA
Gene ID - Mouse ENSMUSG00000018661
Gene ID - Rat ENSRNOG00000002795
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COG1 pAb (ATL-HPA029224)
Datasheet Anti COG1 pAb (ATL-HPA029224) Datasheet (External Link)
Vendor Page Anti COG1 pAb (ATL-HPA029224) at Atlas Antibodies

Documents & Links for Anti COG1 pAb (ATL-HPA029224)
Datasheet Anti COG1 pAb (ATL-HPA029224) Datasheet (External Link)
Vendor Page Anti COG1 pAb (ATL-HPA029224)