Anti COBL pAb (ATL-HPA019167 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019167-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: COBL
Alternative Gene Name: KIAA0633
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020173: 94%, ENSRNOG00000004281: 92%
Entrez Gene ID: 23242
Uniprot ID: O75128
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT |
| Gene Sequence | AVVRVSPEVPLQNILPVICAKCEVSPEHVVLLRDNIAGEELELSKSLNELGIKELYAWDNRRETFRKSSLGNDETDKEKKKFLGFFKVNKRSNSKGCLT |
| Gene ID - Mouse | ENSMUSG00000020173 |
| Gene ID - Rat | ENSRNOG00000004281 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) | |
| Datasheet | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) | |
| Datasheet | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti COBL pAb (ATL-HPA019167 w/enhanced validation) |
| Citations for Anti COBL pAb (ATL-HPA019167 w/enhanced validation) – 2 Found |
| Grega-Larson, Nathan E; Crawley, Scott W; Erwin, Amanda L; Tyska, Matthew J. Cordon bleu promotes the assembly of brush border microvilli. Molecular Biology Of The Cell. 2015;26(21):3803-15. PubMed |
| Cracknell, Tobias; Mannsverk, Steinar; Nichols, Angus; Dowle, Adam; Blanco, Gonzalo. Proteomic resolution of IGFN1 complexes reveals a functional interaction with the actin nucleating protein COBL. Experimental Cell Research. 2020;395(2):112179. PubMed |