Anti COA7 pAb (ATL-HPA029926)

Atlas Antibodies

SKU:
ATL-HPA029926-25
  • Immunohistochemical staining of human cerebral cortex shows moderate to strong cytoplasmic positivity in neurons.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleus & mitochondria.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: cytochrome c oxidase assembly factor 7 (putative)
Gene Name: COA7
Alternative Gene Name: C1orf163, FLJ12439, RESA1, SELRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048351: 94%, ENSRNOG00000010636: 94%
Entrez Gene ID: 65260
Uniprot ID: Q96BR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen PGFPKDMDLACKYSMKACDLGHIWACANASRMYKLGDGVDKDEAKAEVLKNRAQQLHKEQQKGVQPLTFG
Gene Sequence PGFPKDMDLACKYSMKACDLGHIWACANASRMYKLGDGVDKDEAKAEVLKNRAQQLHKEQQKGVQPLTFG
Gene ID - Mouse ENSMUSG00000048351
Gene ID - Rat ENSRNOG00000010636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COA7 pAb (ATL-HPA029926)
Datasheet Anti COA7 pAb (ATL-HPA029926) Datasheet (External Link)
Vendor Page Anti COA7 pAb (ATL-HPA029926) at Atlas Antibodies

Documents & Links for Anti COA7 pAb (ATL-HPA029926)
Datasheet Anti COA7 pAb (ATL-HPA029926) Datasheet (External Link)
Vendor Page Anti COA7 pAb (ATL-HPA029926)



Citations for Anti COA7 pAb (ATL-HPA029926) – 3 Found
Mohanraj, Karthik; Wasilewski, Michal; Benincá, Cristiane; Cysewski, Dominik; Poznanski, Jaroslaw; Sakowska, Paulina; Bugajska, Zaneta; Deckers, Markus; Dennerlein, Sven; Fernandez-Vizarra, Erika; Rehling, Peter; Dadlez, Michal; Zeviani, Massimo; Chacinska, Agnieszka. Inhibition of proteasome rescues a pathogenic variant of respiratory chain assembly factor COA7. Embo Molecular Medicine. 2019;11(5)  PubMed
Higuchi, Yujiro; Okunushi, Ryuta; Hara, Taichi; Hashiguchi, Akihiro; Yuan, Junhui; Yoshimura, Akiko; Murayama, Kei; Ohtake, Akira; Ando, Masahiro; Hiramatsu, Yu; Ishihara, Satoshi; Tanabe, Hajime; Okamoto, Yuji; Matsuura, Eiji; Ueda, Takehiro; Toda, Tatsushi; Yamashita, Sumimasa; Yamada, Kenichiro; Koide, Takashi; Yaguchi, Hiroaki; Mitsui, Jun; Ishiura, Hiroyuki; Yoshimura, Jun; Doi, Koichiro; Morishita, Shinichi; Sato, Ken; Nakagawa, Masanori; Yamaguchi, Masamitsu; Tsuji, Shoji; Takashima, Hiroshi. Mutations in COA7 cause spinocerebellar ataxia with axonal neuropathy. Brain : A Journal Of Neurology. 2018;141(6):1622-1636.  PubMed
Chojnacka, Katarzyna Justyna; Elancheliyan, Praveenraj; Mussulini, Ben Hur Marins; Mohanraj, Karthik; Callegari, Sylvie; Gosk, Aleksandra; Banach, Tomasz; Góral, Tomasz; Szczepanowska, Karolina; Rehling, Peter; Serwa, Remigiusz Adam; Chacinska, Agnieszka. Ovarian carcinoma immunoreactive antigen-like protein 2 (OCIAD2) is a novel complex III-specific assembly factor in mitochondria. Molecular Biology Of The Cell. 2022;33(4):ar29.  PubMed