Anti COA7 pAb (ATL-HPA028154)

Atlas Antibodies

SKU:
ATL-HPA028154-100
  • Immunohistochemical staining of human esophagus shows strong cytoplasmic and nuclear positivity in squamous epithelial cells.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: cytochrome c oxidase assembly factor 7 (putative)
Gene Name: COA7
Alternative Gene Name: C1orf163, FLJ12439, RESA1, SELRC1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000048351: 88%, ENSRNOG00000010636: 86%
Entrez Gene ID: 65260
Uniprot ID: Q96BR5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKFNCEENQHSDSCYKLGAYYVTGKG
Gene Sequence GMVDFQDEEQVKSFLENMEVECNYHCYHEKDPDGCYRLVDYLEGIRKNFDEAAKVLKFNCEENQHSDSCYKLGAYYVTGKG
Gene ID - Mouse ENSMUSG00000048351
Gene ID - Rat ENSRNOG00000010636
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti COA7 pAb (ATL-HPA028154)
Datasheet Anti COA7 pAb (ATL-HPA028154) Datasheet (External Link)
Vendor Page Anti COA7 pAb (ATL-HPA028154) at Atlas Antibodies

Documents & Links for Anti COA7 pAb (ATL-HPA028154)
Datasheet Anti COA7 pAb (ATL-HPA028154) Datasheet (External Link)
Vendor Page Anti COA7 pAb (ATL-HPA028154)