Anti COA6 pAb (ATL-HPA028588)

Atlas Antibodies

Catalog No.:
ATL-HPA028588-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: cytochrome c oxidase assembly factor 6 homolog (S. cerevisiae)
Gene Name: COA6
Alternative Gene Name: C1orf31
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051671: 80%, ENSRNOG00000052701: 76%
Entrez Gene ID: 388753
Uniprot ID: Q5JTJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTA
Gene Sequence PSMKERQVCWGARDEYWKCLDENLEDASQCKKLRSSFESSCPQQWIKYFDKRRDYLKFKEKFEAGQFEPSETTA
Gene ID - Mouse ENSMUSG00000051671
Gene ID - Rat ENSRNOG00000052701
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COA6 pAb (ATL-HPA028588)
Datasheet Anti COA6 pAb (ATL-HPA028588) Datasheet (External Link)
Vendor Page Anti COA6 pAb (ATL-HPA028588) at Atlas Antibodies

Documents & Links for Anti COA6 pAb (ATL-HPA028588)
Datasheet Anti COA6 pAb (ATL-HPA028588) Datasheet (External Link)
Vendor Page Anti COA6 pAb (ATL-HPA028588)
Citations for Anti COA6 pAb (ATL-HPA028588) – 1 Found
Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615.  PubMed