Anti COA5 pAb (ATL-HPA057768)

Atlas Antibodies

Catalog No.:
ATL-HPA057768-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cytochrome c oxidase assembly factor 5
Gene Name: COA5
Alternative Gene Name: C2orf64, FLJ27524, MGC52110, Pet191
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026112: 81%, ENSRNOG00000018102: 81%
Entrez Gene ID: 493753
Uniprot ID: Q86WW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR
Gene Sequence PKYYEDKPQGGACAGLKEDLGACLLQSDCVVQEGKSPRQCLKEGYCNSLKYAFFECKRSVLDNRARFR
Gene ID - Mouse ENSMUSG00000026112
Gene ID - Rat ENSRNOG00000018102
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COA5 pAb (ATL-HPA057768)
Datasheet Anti COA5 pAb (ATL-HPA057768) Datasheet (External Link)
Vendor Page Anti COA5 pAb (ATL-HPA057768) at Atlas Antibodies

Documents & Links for Anti COA5 pAb (ATL-HPA057768)
Datasheet Anti COA5 pAb (ATL-HPA057768) Datasheet (External Link)
Vendor Page Anti COA5 pAb (ATL-HPA057768)
Citations for Anti COA5 pAb (ATL-HPA057768) – 1 Found
Nývltová, Eva; Dietz, Jonathan V; Seravalli, Javier; Khalimonchuk, Oleh; Barrientos, Antoni. Coordination of metal center biogenesis in human cytochrome c oxidase. Nature Communications. 2022;13(1):3615.  PubMed