Anti COA4 pAb (ATL-HPA040126)

Atlas Antibodies

Catalog No.:
ATL-HPA040126-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: cytochrome c oxidase assembly factor 4 homolog (S. cerevisiae)
Gene Name: COA4
Alternative Gene Name: CHCHD8, CMC3, E2IG2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044881: 89%, ENSRNOG00000025385: 89%
Entrez Gene ID: 51287
Uniprot ID: Q9NYJ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEE
Gene Sequence MSTSVPQGHTWTQRVKKDDEEEDPLDQLISRSGCAASHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEE
Gene ID - Mouse ENSMUSG00000044881
Gene ID - Rat ENSRNOG00000025385
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti COA4 pAb (ATL-HPA040126)
Datasheet Anti COA4 pAb (ATL-HPA040126) Datasheet (External Link)
Vendor Page Anti COA4 pAb (ATL-HPA040126) at Atlas Antibodies

Documents & Links for Anti COA4 pAb (ATL-HPA040126)
Datasheet Anti COA4 pAb (ATL-HPA040126) Datasheet (External Link)
Vendor Page Anti COA4 pAb (ATL-HPA040126)
Citations for Anti COA4 pAb (ATL-HPA040126) – 1 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed