Anti COA1 pAb (ATL-HPA011944)

Atlas Antibodies

Catalog No.: ATL-HPA011944-25

Protein Description: cytochrome c oxidase assembly factor 1 homolog (S. cerevisiae)
Gene Name: COA1
Alternative Gene Name: C7orf44, FLJ10803, MITRAC15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033987: 24%, ENSRNOG00000004171: 23%
Entrez Gene ID: 55744
Uniprot ID: Q9GZY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVK
• Gene Sequence: HSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVK
• Gene ID - Mouse: ENSMUSG00000033987
• Gene ID - Rat: ENSRNOG00000004171
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.