Anti COA1 pAb (ATL-HPA011944)
Atlas Antibodies
- Catalog No.:
- ATL-HPA011944-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: COA1
Alternative Gene Name: C7orf44, FLJ10803, MITRAC15
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033987: 24%, ENSRNOG00000004171: 23%
Entrez Gene ID: 55744
Uniprot ID: Q9GZY4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | HSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVK |
| Gene Sequence | HSRALYYKLAVEQLQSHPEAQEALGPPLNIHYLKLIDRENFVDIVDAKLKIPVSGSKSEGLLYVHSSRGGPFQRWHLDEVFLELKDGQQIPVFKLSGENGDEVK |
| Gene ID - Mouse | ENSMUSG00000033987 |
| Gene ID - Rat | ENSRNOG00000004171 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti COA1 pAb (ATL-HPA011944) | |
| Datasheet | Anti COA1 pAb (ATL-HPA011944) Datasheet (External Link) |
| Vendor Page | Anti COA1 pAb (ATL-HPA011944) at Atlas Antibodies |
| Documents & Links for Anti COA1 pAb (ATL-HPA011944) | |
| Datasheet | Anti COA1 pAb (ATL-HPA011944) Datasheet (External Link) |
| Vendor Page | Anti COA1 pAb (ATL-HPA011944) |