Anti CNTROB pAb (ATL-HPA023321)

Atlas Antibodies

Catalog No.:
ATL-HPA023321-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: centrobin, centrosomal BRCA2 interacting protein
Gene Name: CNTROB
Alternative Gene Name: LIP8, PP1221
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032782: 87%, ENSRNOG00000008270: 86%
Entrez Gene ID: 116840
Uniprot ID: Q8N137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDGFAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDSTATLLNTRPLQDLSPSSS
Gene Sequence VTSQLYASLRLSRQAEATARAQLYLPSTSPPHEGLDGFAQELSRSLSVGLEKNLKKKDGSKHIFEMESVRGQLQTMLQTSRDTAYRDPLIPGAGSERREEDSFDSDSTATLLNTRPLQDLSPSSS
Gene ID - Mouse ENSMUSG00000032782
Gene ID - Rat ENSRNOG00000008270
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNTROB pAb (ATL-HPA023321)
Datasheet Anti CNTROB pAb (ATL-HPA023321) Datasheet (External Link)
Vendor Page Anti CNTROB pAb (ATL-HPA023321) at Atlas Antibodies

Documents & Links for Anti CNTROB pAb (ATL-HPA023321)
Datasheet Anti CNTROB pAb (ATL-HPA023321) Datasheet (External Link)
Vendor Page Anti CNTROB pAb (ATL-HPA023321)
Citations for Anti CNTROB pAb (ATL-HPA023321) – 2 Found
Gavilan, Maria P; Gandolfo, Pablo; Balestra, Fernando R; Arias, Francisco; Bornens, Michel; Rios, Rosa M. The dual role of the centrosome in organizing the microtubule network in interphase. Embo Reports. 2018;19(11)  PubMed
Balestra, Fernando R; Domínguez-Calvo, Andrés; Wolf, Benita; Busso, Coralie; Buff, Alizée; Averink, Tessa; Lipsanen-Nyman, Marita; Huertas, Pablo; Ríos, Rosa M; Gönczy, Pierre. TRIM37 prevents formation of centriolar protein assemblies by regulating Centrobin. Elife. 2021;10( 33491649)  PubMed