Anti CNTROB pAb (ATL-HPA023320)

Atlas Antibodies

SKU: ATL-HPA023320-25

• 

Protein Description: centrobin, centrosomal BRCA2 interacting protein
Gene Name: CNTROB
Alternative Gene Name: LIP8, PP1221
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032782: 71%, ENSRNOG00000008270: 75%
Entrez Gene ID: 116840
Uniprot ID: Q8N137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLHQLLETVPQNNEN
• Gene Sequence: SQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLHQLLETVPQNNEN
• Gene ID - Mouse: ENSMUSG00000032782
• Gene ID - Rat: ENSRNOG00000008270
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.