Anti CNTROB pAb (ATL-HPA023320)

Atlas Antibodies

Catalog No.:
ATL-HPA023320-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: centrobin, centrosomal BRCA2 interacting protein
Gene Name: CNTROB
Alternative Gene Name: LIP8, PP1221
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032782: 71%, ENSRNOG00000008270: 75%
Entrez Gene ID: 116840
Uniprot ID: Q8N137
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLHQLLETVPQNNEN
Gene Sequence SQHSFQPLEPKPDLTSSTAGAFSALGAFHPDHRAERPFPEEDPGPDGEGLLKQGLPPAQLEGLKNFLHQLLETVPQNNEN
Gene ID - Mouse ENSMUSG00000032782
Gene ID - Rat ENSRNOG00000008270
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNTROB pAb (ATL-HPA023320)
Datasheet Anti CNTROB pAb (ATL-HPA023320) Datasheet (External Link)
Vendor Page Anti CNTROB pAb (ATL-HPA023320) at Atlas Antibodies

Documents & Links for Anti CNTROB pAb (ATL-HPA023320)
Datasheet Anti CNTROB pAb (ATL-HPA023320) Datasheet (External Link)
Vendor Page Anti CNTROB pAb (ATL-HPA023320)