Anti CNTRL pAb (ATL-HPA020480)

Atlas Antibodies

SKU:
ATL-HPA020480-25
  • Immunohistochemical staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: centriolin
Gene Name: CNTRL
Alternative Gene Name: CEP1, CEP110
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057110: 81%, ENSRNOG00000022015: 78%
Entrez Gene ID: 11064
Uniprot ID: Q7Z7A1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen IELTRACQKQYELEQELAFYKIDAKFEPLNYYPSEYAEIDKAPDESPYIGKSRYKRNMFATESYIIDSAQAVQIKKMEPDEQLRNDHMNLRGHTPLDTQLEDKEKKISAAQTRLSEL
Gene Sequence IELTRACQKQYELEQELAFYKIDAKFEPLNYYPSEYAEIDKAPDESPYIGKSRYKRNMFATESYIIDSAQAVQIKKMEPDEQLRNDHMNLRGHTPLDTQLEDKEKKISAAQTRLSEL
Gene ID - Mouse ENSMUSG00000057110
Gene ID - Rat ENSRNOG00000022015
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNTRL pAb (ATL-HPA020480)
Datasheet Anti CNTRL pAb (ATL-HPA020480) Datasheet (External Link)
Vendor Page Anti CNTRL pAb (ATL-HPA020480) at Atlas Antibodies

Documents & Links for Anti CNTRL pAb (ATL-HPA020480)
Datasheet Anti CNTRL pAb (ATL-HPA020480) Datasheet (External Link)
Vendor Page Anti CNTRL pAb (ATL-HPA020480)