Anti CNTNAP4 pAb (ATL-HPA057342)

Atlas Antibodies

Catalog No.:
ATL-HPA057342-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: contactin associated protein-like 4
Gene Name: CNTNAP4
Alternative Gene Name: CASPR4, KIAA1763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031772: 86%, ENSRNOG00000011231: 86%
Entrez Gene ID: 85445
Uniprot ID: Q9C0A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSD
Gene Sequence TESSCMAQPGTDATSRERTHSFADHSGTIDDREPLANAIKSD
Gene ID - Mouse ENSMUSG00000031772
Gene ID - Rat ENSRNOG00000011231
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNTNAP4 pAb (ATL-HPA057342)
Datasheet Anti CNTNAP4 pAb (ATL-HPA057342) Datasheet (External Link)
Vendor Page Anti CNTNAP4 pAb (ATL-HPA057342) at Atlas Antibodies

Documents & Links for Anti CNTNAP4 pAb (ATL-HPA057342)
Datasheet Anti CNTNAP4 pAb (ATL-HPA057342) Datasheet (External Link)
Vendor Page Anti CNTNAP4 pAb (ATL-HPA057342)