Anti CNTNAP4 pAb (ATL-HPA031859 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA031859-25

• 
• 

Protein Description: contactin associated protein-like 4
Gene Name: CNTNAP4
Alternative Gene Name: CASPR4, KIAA1763
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031772: 79%, ENSRNOG00000011231: 72%
Entrez Gene ID: 85445
Uniprot ID: Q9C0A0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: CNMTETAWTIIQHNGSDLTRVRNTNPENPYAGFFEYVASMEQLQATINRAEHCEQEFTYYCKKSRLVN
• Gene Sequence: CNMTETAWTIIQHNGSDLTRVRNTNPENPYAGFFEYVASMEQLQATINRAEHCEQEFTYYCKKSRLVN
• Gene ID - Mouse: ENSMUSG00000031772
• Gene ID - Rat: ENSRNOG00000011231
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.