Anti CNTNAP1 pAb (ATL-HPA011772)

Atlas Antibodies

SKU: ATL-HPA011772-25

• 
• 

Protein Description: contactin associated protein 1
Gene Name: CNTNAP1
Alternative Gene Name: Caspr, CNTNAP, NRXN4, p190
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017167: 96%, ENSRNOG00000020277: 96%
Entrez Gene ID: 8506
Uniprot ID: P78357
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MRLNGVTLNLEGRANASEGTSPNCTGHCAHPRLPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSAAREFSHMLSRPVPGYEPGYIPGYDTPGY
• Gene Sequence: MRLNGVTLNLEGRANASEGTSPNCTGHCAHPRLPCFHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFFEPGTWMRYNLQSALRSAAREFSHMLSRPVPGYEPGYIPGYDTPGY
• Gene ID - Mouse: ENSMUSG00000017167
• Gene ID - Rat: ENSRNOG00000020277
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CNTNAP1 pAb (ATL-HPA011772) – 1 Found

Farach, Andrew; Ding, Yi; Lee, MinJae; Creighton, Chad; Delk, Nikki A; Ittmann, Michael; Miles, Brian; Rowley, David; Farach-Carson, Mary C; Ayala, Gustavo E. Neuronal Trans-Differentiation in Prostate Cancer Cells. The Prostate. 2016;76(14):1312-25.