Anti CNTN5 pAb (ATL-HPA039492)

Atlas Antibodies

SKU:
ATL-HPA039492-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in tubular cells.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: contactin 5
Gene Name: CNTN5
Alternative Gene Name: hNB-2, NB-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000039488: 81%, ENSRNOG00000007038: 84%
Entrez Gene ID: 53942
Uniprot ID: O94779
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDII
Gene Sequence KSLPGLSTSYAALLRIKKSSSSSLFGSKTRPRYSSPSLGTLSASSPSWLGAAQNYYSPINLYHSSDAFKQDESVDYGPVFVQEPDDII
Gene ID - Mouse ENSMUSG00000039488
Gene ID - Rat ENSRNOG00000007038
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNTN5 pAb (ATL-HPA039492)
Datasheet Anti CNTN5 pAb (ATL-HPA039492) Datasheet (External Link)
Vendor Page Anti CNTN5 pAb (ATL-HPA039492) at Atlas Antibodies

Documents & Links for Anti CNTN5 pAb (ATL-HPA039492)
Datasheet Anti CNTN5 pAb (ATL-HPA039492) Datasheet (External Link)
Vendor Page Anti CNTN5 pAb (ATL-HPA039492)