Anti CNTN2 pAb (ATL-HPA001397)
Atlas Antibodies
- Catalog No.:
- ATL-HPA001397-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CNTN2
Alternative Gene Name: AXT, TAG-1, TAX, TAX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053024: 85%, ENSRNOG00000009033: 84%
Entrez Gene ID: 6900
Uniprot ID: Q02246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL |
Gene Sequence | PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL |
Gene ID - Mouse | ENSMUSG00000053024 |
Gene ID - Rat | ENSRNOG00000009033 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNTN2 pAb (ATL-HPA001397) | |
Datasheet | Anti CNTN2 pAb (ATL-HPA001397) Datasheet (External Link) |
Vendor Page | Anti CNTN2 pAb (ATL-HPA001397) at Atlas Antibodies |
Documents & Links for Anti CNTN2 pAb (ATL-HPA001397) | |
Datasheet | Anti CNTN2 pAb (ATL-HPA001397) Datasheet (External Link) |
Vendor Page | Anti CNTN2 pAb (ATL-HPA001397) |
Citations for Anti CNTN2 pAb (ATL-HPA001397) – 2 Found |
Chatterjee, Madhurima; Del Campo, Marta; Morrema, Tjado H J; de Waal, Matthijs; van der Flier, Wiesje M; Hoozemans, Jeroen J M; Teunissen, Charlotte E. Contactin-2, a synaptic and axonal protein, is reduced in cerebrospinal fluid and brain tissue in Alzheimer's disease. Alzheimer's Research & Therapy. 2018;10(1):52. PubMed |
Chatterjee, Madhurima; van Steenoven, Inger; Huisman, Evelien; Oosterveld, Linda; Berendse, Henk; van der Flier, Wiesje M; Del Campo, Marta; Lemstra, Afina W; van de Berg, Wilma D J; Teunissen, Charlotte E. Contactin-1 Is Reduced in Cerebrospinal Fluid of Parkinson's Disease Patients and Is Present within Lewy Bodies. Biomolecules. 2020;10(8) PubMed |