Anti CNTN2 pAb (ATL-HPA001397)

Atlas Antibodies

SKU: ATL-HPA001397-25

• 

Protein Description: contactin 2 (axonal)
Gene Name: CNTN2
Alternative Gene Name: AXT, TAG-1, TAX, TAX1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053024: 85%, ENSRNOG00000009033: 84%
Entrez Gene ID: 6900
Uniprot ID: Q02246
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL
• Gene Sequence: PASPSANATTMKPPPRRPPGNISWTFSSSSLSIKWDPVVPFRNESAVTGYKMLYQNDLHLTPTLHLTGKNWIEIPVPEDIGHALVQIRTTGPGGDGIPAEVHIVRNGGTSMMVENMAVRPAPHPGTVISHSVAMLIL
• Gene ID - Mouse: ENSMUSG00000053024
• Gene ID - Rat: ENSRNOG00000009033
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CNTN2 pAb (ATL-HPA001397) – 2 Found

Chatterjee, Madhurima; Del Campo, Marta; Morrema, Tjado H J; de Waal, Matthijs; van der Flier, Wiesje M; Hoozemans, Jeroen J M; Teunissen, Charlotte E. Contactin-2, a synaptic and axonal protein, is reduced in cerebrospinal fluid and brain tissue in Alzheimer's disease. Alzheimer's Research & Therapy. 2018;10(1):52. 

Chatterjee, Madhurima; van Steenoven, Inger; Huisman, Evelien; Oosterveld, Linda; Berendse, Henk; van der Flier, Wiesje M; Del Campo, Marta; Lemstra, Afina W; van de Berg, Wilma D J; Teunissen, Charlotte E. Contactin-1 Is Reduced in Cerebrospinal Fluid of Parkinson's Disease Patients and Is Present within Lewy Bodies. Biomolecules. 2020;10(8)