Anti CNTN1 pAb (ATL-HPA070467)
Atlas Antibodies
- Catalog No.:
- ATL-HPA070467-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: CNTN1
Alternative Gene Name: F3, GP135
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055022: 92%, ENSRNOG00000004438: 92%
Entrez Gene ID: 1272
Uniprot ID: Q12860
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human, Mouse |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | TNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQ |
| Gene Sequence | TNGNLYIANVEASDKGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPYPADIVVQFKDVYALMGQ |
| Gene ID - Mouse | ENSMUSG00000055022 |
| Gene ID - Rat | ENSRNOG00000004438 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNTN1 pAb (ATL-HPA070467) | |
| Datasheet | Anti CNTN1 pAb (ATL-HPA070467) Datasheet (External Link) |
| Vendor Page | Anti CNTN1 pAb (ATL-HPA070467) at Atlas Antibodies |
| Documents & Links for Anti CNTN1 pAb (ATL-HPA070467) | |
| Datasheet | Anti CNTN1 pAb (ATL-HPA070467) Datasheet (External Link) |
| Vendor Page | Anti CNTN1 pAb (ATL-HPA070467) |
| Citations for Anti CNTN1 pAb (ATL-HPA070467) – 1 Found |
| Endmayr, Verena; Tunc, Cansu; Ergin, Lara; De Rosa, Anna; Weng, Rosa; Wagner, Lukas; Yu, Thin-Yau; Fichtenbaum, Andreas; Perkmann, Thomas; Haslacher, Helmuth; Kozakowski, Nicolas; Schwaiger, Carmen; Ricken, Gerda; Hametner, Simon; Klotz, Sigrid; Dutra, Lívia Almeida; Lechner, Christian; de Simoni, Désirée; Poppert, Kai-Nicolas; Müller, Georg Johannes; Pirker, Susanne; Pirker, Walter; Angelovski, Aleksandra; Valach, Matus; Maestri, Michelangelo; Guida, Melania; Ricciardi, Roberta; Frommlet, Florian; Sieghart, Daniela; Pinter, Miklos; Kircher, Karl; Artacker, Gottfried; Höftberger, Romana; Koneczny, Inga. Anti-Neuronal IgG4 Autoimmune Diseases and IgG4-Related Diseases May Not Be Part of the Same Spectrum: A Comparative Study. Frontiers In Immunology. 12( 35095860):785247. PubMed |