Anti CNTLN pAb (ATL-HPA036729)

Atlas Antibodies

SKU:
ATL-HPA036729-25
  • Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: centlein, centrosomal protein
Gene Name: CNTLN
Alternative Gene Name: bA340N12.1, C9orf101, C9orf39, FLJ20276
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038070: 76%, ENSRNOG00000043151: 39%
Entrez Gene ID: 54875
Uniprot ID: Q9NXG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SGMTEIRKIKRADPQQLRQEDSDAVWNELAYFKRENQELMIQKMNLEEELDELKVHISIDKAAIQELNRCVAERREEQLFRSGEDDEVKRSTPEKNGKEML
Gene Sequence SGMTEIRKIKRADPQQLRQEDSDAVWNELAYFKRENQELMIQKMNLEEELDELKVHISIDKAAIQELNRCVAERREEQLFRSGEDDEVKRSTPEKNGKEML
Gene ID - Mouse ENSMUSG00000038070
Gene ID - Rat ENSRNOG00000043151
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNTLN pAb (ATL-HPA036729)
Datasheet Anti CNTLN pAb (ATL-HPA036729) Datasheet (External Link)
Vendor Page Anti CNTLN pAb (ATL-HPA036729) at Atlas Antibodies

Documents & Links for Anti CNTLN pAb (ATL-HPA036729)
Datasheet Anti CNTLN pAb (ATL-HPA036729) Datasheet (External Link)
Vendor Page Anti CNTLN pAb (ATL-HPA036729)