Anti CNTLN pAb (ATL-HPA036729)
Atlas Antibodies
- Catalog No.:
- ATL-HPA036729-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CNTLN
Alternative Gene Name: bA340N12.1, C9orf101, C9orf39, FLJ20276
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038070: 76%, ENSRNOG00000043151: 39%
Entrez Gene ID: 54875
Uniprot ID: Q9NXG0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SGMTEIRKIKRADPQQLRQEDSDAVWNELAYFKRENQELMIQKMNLEEELDELKVHISIDKAAIQELNRCVAERREEQLFRSGEDDEVKRSTPEKNGKEML |
| Gene Sequence | SGMTEIRKIKRADPQQLRQEDSDAVWNELAYFKRENQELMIQKMNLEEELDELKVHISIDKAAIQELNRCVAERREEQLFRSGEDDEVKRSTPEKNGKEML |
| Gene ID - Mouse | ENSMUSG00000038070 |
| Gene ID - Rat | ENSRNOG00000043151 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNTLN pAb (ATL-HPA036729) | |
| Datasheet | Anti CNTLN pAb (ATL-HPA036729) Datasheet (External Link) |
| Vendor Page | Anti CNTLN pAb (ATL-HPA036729) at Atlas Antibodies |
| Documents & Links for Anti CNTLN pAb (ATL-HPA036729) | |
| Datasheet | Anti CNTLN pAb (ATL-HPA036729) Datasheet (External Link) |
| Vendor Page | Anti CNTLN pAb (ATL-HPA036729) |