Anti CNTF pAb (ATL-HPA019654)

Atlas Antibodies

SKU:
ATL-HPA019654-25
  • Immunohistochemical staining of human Cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to vesicles.
  • Western blot analysis in human cell line U-87 MG.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: ciliary neurotrophic factor
Gene Name: CNTF
Alternative Gene Name: HCNTF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079415: 77%, ENSRNOG00000012460: 84%
Entrez Gene ID: 1270
Uniprot ID: P26441
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNK
Gene Sequence FHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNK
Gene ID - Mouse ENSMUSG00000079415
Gene ID - Rat ENSRNOG00000012460
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNTF pAb (ATL-HPA019654)
Datasheet Anti CNTF pAb (ATL-HPA019654) Datasheet (External Link)
Vendor Page Anti CNTF pAb (ATL-HPA019654) at Atlas Antibodies

Documents & Links for Anti CNTF pAb (ATL-HPA019654)
Datasheet Anti CNTF pAb (ATL-HPA019654) Datasheet (External Link)
Vendor Page Anti CNTF pAb (ATL-HPA019654)