Anti CNST pAb (ATL-HPA007226)

Atlas Antibodies

Catalog No.:
ATL-HPA007226-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: consortin, connexin sorting protein
Gene Name: CNST
Alternative Gene Name: C1orf71, FLJ32001, PPP1R64
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038949: 82%, ENSRNOG00000002710: 81%
Entrez Gene ID: 163882
Uniprot ID: Q6PJW8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKG
Gene Sequence AVDDEEAAEVNANEQPEAPKLVLQSLFSLIRGEVEQLDSRALPLCLHQIAESYFQEEDYEKAMKFIQLERLYHEQLLANLSAIQEQWETKWKTVQPHTVTALRNSEKG
Gene ID - Mouse ENSMUSG00000038949
Gene ID - Rat ENSRNOG00000002710
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNST pAb (ATL-HPA007226)
Datasheet Anti CNST pAb (ATL-HPA007226) Datasheet (External Link)
Vendor Page Anti CNST pAb (ATL-HPA007226) at Atlas Antibodies

Documents & Links for Anti CNST pAb (ATL-HPA007226)
Datasheet Anti CNST pAb (ATL-HPA007226) Datasheet (External Link)
Vendor Page Anti CNST pAb (ATL-HPA007226)