Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA025240-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: CNPY4
Alternative Gene Name: MGC40499, PRAT4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036968: 93%, ENSRNOG00000027175: 93%
Entrez Gene ID: 245812
Uniprot ID: Q8N129
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERI |
Gene Sequence | KEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERI |
Gene ID - Mouse | ENSMUSG00000036968 |
Gene ID - Rat | ENSRNOG00000027175 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation) | |
Datasheet | Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation) | |
Datasheet | Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation) |