Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA025240-100
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: canopy FGF signaling regulator 4
Gene Name: CNPY4
Alternative Gene Name: MGC40499, PRAT4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036968: 93%, ENSRNOG00000027175: 93%
Entrez Gene ID: 245812
Uniprot ID: Q8N129
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERI
Gene Sequence KEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERI
Gene ID - Mouse ENSMUSG00000036968
Gene ID - Rat ENSRNOG00000027175
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation)
Datasheet Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation)
Datasheet Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation)