Anti CNPY4 pAb (ATL-HPA025240 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA025240-100

• 
• 
• 

Protein Description: canopy FGF signaling regulator 4
Gene Name: CNPY4
Alternative Gene Name: MGC40499, PRAT4B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036968: 93%, ENSRNOG00000027175: 93%
Entrez Gene ID: 245812
Uniprot ID: Q8N129
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERI
• Gene Sequence: KEEDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALENLCERI
• Gene ID - Mouse: ENSMUSG00000036968
• Gene ID - Rat: ENSRNOG00000027175
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.