Anti CNPY2 pAb (ATL-HPA038466)

Atlas Antibodies

SKU:
ATL-HPA038466-25
  • Immunohistochemical staining of human epididymis shows cytoplasmic positivity in glandular cells.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: canopy FGF signaling regulator 2
Gene Name: CNPY2
Alternative Gene Name: Cnpy2, HP10390, TMEM4, ZSIG9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025381: 97%, ENSRNOG00000003549: 98%
Entrez Gene ID: 10330
Uniprot ID: Q9Y2B0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSD
Gene Sequence RRSQDLHCGACRALVDELEWEIAQVDPKKTIQMGSFRINPDGSQSVVEVPYARSEAHLTELLEEICDRMKEYGEQIDPSTHRKNYVRVVGRNGESSELDLQGIRIDSD
Gene ID - Mouse ENSMUSG00000025381
Gene ID - Rat ENSRNOG00000003549
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNPY2 pAb (ATL-HPA038466)
Datasheet Anti CNPY2 pAb (ATL-HPA038466) Datasheet (External Link)
Vendor Page Anti CNPY2 pAb (ATL-HPA038466) at Atlas Antibodies

Documents & Links for Anti CNPY2 pAb (ATL-HPA038466)
Datasheet Anti CNPY2 pAb (ATL-HPA038466) Datasheet (External Link)
Vendor Page Anti CNPY2 pAb (ATL-HPA038466)