Anti CNPY1 pAb (ATL-HPA047400)

Atlas Antibodies

Catalog No.:
ATL-HPA047400-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: canopy FGF signaling regulator 1
Gene Name: CNPY1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044681: 72%, ENSRNOG00000028311: 75%
Entrez Gene ID: 285888
Uniprot ID: Q3B7I2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANH
Gene Sequence DPVTKERTFKRFAPRKGDKIYQEFKKLYFYSDAYRPLKFACETIIEEYEDEISSLIAQETHYLADKLCSEKSDLCETSANH
Gene ID - Mouse ENSMUSG00000044681
Gene ID - Rat ENSRNOG00000028311
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNPY1 pAb (ATL-HPA047400)
Datasheet Anti CNPY1 pAb (ATL-HPA047400) Datasheet (External Link)
Vendor Page Anti CNPY1 pAb (ATL-HPA047400) at Atlas Antibodies

Documents & Links for Anti CNPY1 pAb (ATL-HPA047400)
Datasheet Anti CNPY1 pAb (ATL-HPA047400) Datasheet (External Link)
Vendor Page Anti CNPY1 pAb (ATL-HPA047400)