Anti CNOT8 pAb (ATL-HPA051398)

Atlas Antibodies

Catalog No.:
ATL-HPA051398-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CCR4-NOT transcription complex, subunit 8
Gene Name: CNOT8
Alternative Gene Name: CAF1, CALIF, hCAF1, POP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020515: 95%, ENSRNOG00000002630: 97%
Entrez Gene ID: 9337
Uniprot ID: Q9UFF9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Gene Sequence CGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ
Gene ID - Mouse ENSMUSG00000020515
Gene ID - Rat ENSRNOG00000002630
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNOT8 pAb (ATL-HPA051398)
Datasheet Anti CNOT8 pAb (ATL-HPA051398) Datasheet (External Link)
Vendor Page Anti CNOT8 pAb (ATL-HPA051398) at Atlas Antibodies

Documents & Links for Anti CNOT8 pAb (ATL-HPA051398)
Datasheet Anti CNOT8 pAb (ATL-HPA051398) Datasheet (External Link)
Vendor Page Anti CNOT8 pAb (ATL-HPA051398)