Anti CNOT6 pAb (ATL-HPA044568)
Atlas Antibodies
- Catalog No.:
- ATL-HPA044568-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: CNOT6
Alternative Gene Name: CCR4, Ccr4a, KIAA1194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020362: 98%, ENSRNOG00000054891: 88%
Entrez Gene ID: 57472
Uniprot ID: Q9ULM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN |
| Gene Sequence | RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN |
| Gene ID - Mouse | ENSMUSG00000020362 |
| Gene ID - Rat | ENSRNOG00000054891 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti CNOT6 pAb (ATL-HPA044568) | |
| Datasheet | Anti CNOT6 pAb (ATL-HPA044568) Datasheet (External Link) |
| Vendor Page | Anti CNOT6 pAb (ATL-HPA044568) at Atlas Antibodies |
| Documents & Links for Anti CNOT6 pAb (ATL-HPA044568) | |
| Datasheet | Anti CNOT6 pAb (ATL-HPA044568) Datasheet (External Link) |
| Vendor Page | Anti CNOT6 pAb (ATL-HPA044568) |