Anti CNOT6 pAb (ATL-HPA044568)

Atlas Antibodies

Catalog No.:
ATL-HPA044568-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: CCR4-NOT transcription complex, subunit 6
Gene Name: CNOT6
Alternative Gene Name: CCR4, Ccr4a, KIAA1194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020362: 98%, ENSRNOG00000054891: 88%
Entrez Gene ID: 57472
Uniprot ID: Q9ULM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN
Gene Sequence RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN
Gene ID - Mouse ENSMUSG00000020362
Gene ID - Rat ENSRNOG00000054891
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNOT6 pAb (ATL-HPA044568)
Datasheet Anti CNOT6 pAb (ATL-HPA044568) Datasheet (External Link)
Vendor Page Anti CNOT6 pAb (ATL-HPA044568) at Atlas Antibodies

Documents & Links for Anti CNOT6 pAb (ATL-HPA044568)
Datasheet Anti CNOT6 pAb (ATL-HPA044568) Datasheet (External Link)
Vendor Page Anti CNOT6 pAb (ATL-HPA044568)