Anti CNOT6 pAb (ATL-HPA044568)

Atlas Antibodies

Catalog No.: ATL-HPA044568-25

Protein Description: CCR4-NOT transcription complex, subunit 6
Gene Name: CNOT6
Alternative Gene Name: CCR4, Ccr4a, KIAA1194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020362: 98%, ENSRNOG00000054891: 88%
Entrez Gene ID: 57472
Uniprot ID: Q9ULM6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN
• Gene Sequence: RLLNYLLDNLSGTAKRITTEQPPPRSWIMLQEPDRTRPTALFSVMCYN
• Gene ID - Mouse: ENSMUSG00000020362
• Gene ID - Rat: ENSRNOG00000054891
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.