Anti CNOT3 pAb (ATL-HPA006408)

Atlas Antibodies

SKU:
ATL-HPA006408-100
  • Immunohistochemical staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: CCR4-NOT transcription complex, subunit 3
Gene Name: CNOT3
Alternative Gene Name: KIAA0691, LENG2, NOT3, NOT3H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035632: 83%, ENSRNOG00000053234: 83%
Entrez Gene ID: 4849
Uniprot ID: O75175
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSA
Gene Sequence TPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSA
Gene ID - Mouse ENSMUSG00000035632
Gene ID - Rat ENSRNOG00000053234
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNOT3 pAb (ATL-HPA006408)
Datasheet Anti CNOT3 pAb (ATL-HPA006408) Datasheet (External Link)
Vendor Page Anti CNOT3 pAb (ATL-HPA006408) at Atlas Antibodies

Documents & Links for Anti CNOT3 pAb (ATL-HPA006408)
Datasheet Anti CNOT3 pAb (ATL-HPA006408) Datasheet (External Link)
Vendor Page Anti CNOT3 pAb (ATL-HPA006408)