Anti CNOT2 pAb (ATL-HPA067711)

Atlas Antibodies

Catalog No.:
ATL-HPA067711-25
Shipping:
Calculated at Checkout
$324.00
Adding to cart… The item has been added
Protein Description: CCR4-NOT transcription complex, subunit 2
Gene Name: CNOT2
Alternative Gene Name: CDC36, NOT2, NOT2H
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020166: 100%, ENSRNOG00000004909: 100%
Entrez Gene ID: 4848
Uniprot ID: Q9NZN8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPT
Gene Sequence DGSENVTGLDLSDFPALADRNRREGSGNPTPLINPLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPT
Gene ID - Mouse ENSMUSG00000020166
Gene ID - Rat ENSRNOG00000004909
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNOT2 pAb (ATL-HPA067711)
Datasheet Anti CNOT2 pAb (ATL-HPA067711) Datasheet (External Link)
Vendor Page Anti CNOT2 pAb (ATL-HPA067711) at Atlas Antibodies

Documents & Links for Anti CNOT2 pAb (ATL-HPA067711)
Datasheet Anti CNOT2 pAb (ATL-HPA067711) Datasheet (External Link)
Vendor Page Anti CNOT2 pAb (ATL-HPA067711)