Anti CNOT11 pAb (ATL-HPA074943)

Atlas Antibodies

SKU: ATL-HPA074943-25

• 
• 

Protein Description: CCR4-NOT transcription complex subunit 11
Gene Name: CNOT11
Alternative Gene Name: C2orf29, C40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003135: 100%, ENSRNOG00000023220: 100%
Entrez Gene ID: 55571
Uniprot ID: Q9UKZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HHYFSKADHFRLGSVLVMLLQQPDLLPSAAQRLTALYLLWEMYRTEPLAANPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPE
• Gene Sequence: HHYFSKADHFRLGSVLVMLLQQPDLLPSAAQRLTALYLLWEMYRTEPLAANPFAASFAHLLNPAPPARGGQEPDRPPLSGFLPPITPPE
• Gene ID - Mouse: ENSMUSG00000003135
• Gene ID - Rat: ENSRNOG00000023220
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.