Anti CNOT11 pAb (ATL-HPA069823)

Atlas Antibodies

Catalog No.:
ATL-HPA069823-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: CCR4-NOT transcription complex, subunit 11
Gene Name: CNOT11
Alternative Gene Name: C2orf29, C40
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000003135: 98%, ENSRNOG00000023220: 98%
Entrez Gene ID: 55571
Uniprot ID: Q9UKZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRPEFIRPPPPLHICEDELAWLNPTEPDHAIQWDKSMCVKNSTGVEIKRIMAKAFKSPLSSPQQTQLLGELEKDPKLVYHIGLT
Gene Sequence FRPEFIRPPPPLHICEDELAWLNPTEPDHAIQWDKSMCVKNSTGVEIKRIMAKAFKSPLSSPQQTQLLGELEKDPKLVYHIGLT
Gene ID - Mouse ENSMUSG00000003135
Gene ID - Rat ENSRNOG00000023220
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNOT11 pAb (ATL-HPA069823)
Datasheet Anti CNOT11 pAb (ATL-HPA069823) Datasheet (External Link)
Vendor Page Anti CNOT11 pAb (ATL-HPA069823) at Atlas Antibodies

Documents & Links for Anti CNOT11 pAb (ATL-HPA069823)
Datasheet Anti CNOT11 pAb (ATL-HPA069823) Datasheet (External Link)
Vendor Page Anti CNOT11 pAb (ATL-HPA069823)