Anti CNOT10 pAb (ATL-HPA041450)

Atlas Antibodies

SKU:
ATL-HPA041450-25
  • Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm, cytosol & centrosome.
  • Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: CCR4-NOT transcription complex, subunit 10
Gene Name: CNOT10
Alternative Gene Name: FLJ12890, FLJ13165
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056167: 99%, ENSRNOG00000052305: 98%
Entrez Gene ID: 25904
Uniprot ID: Q9H9A5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGIVQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPV
Gene Sequence PLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGIVQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPV
Gene ID - Mouse ENSMUSG00000056167
Gene ID - Rat ENSRNOG00000052305
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti CNOT10 pAb (ATL-HPA041450)
Datasheet Anti CNOT10 pAb (ATL-HPA041450) Datasheet (External Link)
Vendor Page Anti CNOT10 pAb (ATL-HPA041450) at Atlas Antibodies

Documents & Links for Anti CNOT10 pAb (ATL-HPA041450)
Datasheet Anti CNOT10 pAb (ATL-HPA041450) Datasheet (External Link)
Vendor Page Anti CNOT10 pAb (ATL-HPA041450)