Anti CNOT10 pAb (ATL-HPA041450)

Atlas Antibodies

Catalog No.: ATL-HPA041450-25

Protein Description: CCR4-NOT transcription complex, subunit 10
Gene Name: CNOT10
Alternative Gene Name: FLJ12890, FLJ13165
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056167: 99%, ENSRNOG00000052305: 98%
Entrez Gene ID: 25904
Uniprot ID: Q9H9A5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGIVQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPV
• Gene Sequence: PLAAFECLIEAVQVYHANPRLWLRLAECCIAANKGTSEQETKGLPSKKGIVQSIVGQGYHRKIVLASQSIQNTVYNDGQSSAIPV
• Gene ID - Mouse: ENSMUSG00000056167
• Gene ID - Rat: ENSRNOG00000052305
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.