Anti CNNM4 pAb (ATL-HPA017732 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA017732-25

• 

Protein Description: cyclin and CBS domain divalent metal cation transport mediator 4
Gene Name: CNNM4
Alternative Gene Name: ACDP4, KIAA1592
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037408: 77%, ENSRNOG00000015886: 78%
Entrez Gene ID: 26504
Uniprot ID: Q6P4Q7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL
• Gene Sequence: FSYYGTMALTSVPSDRSPAHPTPLSRSASLSYPDRTDVSTAATLAGSSNQFGSSVLGQYISDFSVRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSL
• Gene ID - Mouse: ENSMUSG00000037408
• Gene ID - Rat: ENSRNOG00000015886
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti CNNM4 pAb (ATL-HPA017732 w/enhanced validation) – 1 Found

Parry, David A; Mighell, Alan J; El-Sayed, Walid; Shore, Roger C; Jalili, Ismail K; Dollfus, Hélène; Bloch-Zupan, Agnes; Carlos, Roman; Carr, Ian M; Downey, Louise M; Blain, Katharine M; Mansfield, David C; Shahrabi, Mehdi; Heidari, Mansour; Aref, Parissa; Abbasi, Mohsen; Michaelides, Michel; Moore, Anthony T; Kirkham, Jennifer; Inglehearn, Chris F. Mutations in CNNM4 cause Jalili syndrome, consisting of autosomal-recessive cone-rod dystrophy and amelogenesis imperfecta. American Journal Of Human Genetics. 2009;84(2):266-73.