Anti CNNM1 pAb (ATL-HPA040408)

Atlas Antibodies

Catalog No.:
ATL-HPA040408-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: cyclin and CBS domain divalent metal cation transport mediator 1
Gene Name: CNNM1
Alternative Gene Name: ACDP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025189: 86%, ENSRNOG00000016302: 86%
Entrez Gene ID: 26507
Uniprot ID: Q9NRU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen TACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLT
Gene Sequence TACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLT
Gene ID - Mouse ENSMUSG00000025189
Gene ID - Rat ENSRNOG00000016302
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNNM1 pAb (ATL-HPA040408)
Datasheet Anti CNNM1 pAb (ATL-HPA040408) Datasheet (External Link)
Vendor Page Anti CNNM1 pAb (ATL-HPA040408) at Atlas Antibodies

Documents & Links for Anti CNNM1 pAb (ATL-HPA040408)
Datasheet Anti CNNM1 pAb (ATL-HPA040408) Datasheet (External Link)
Vendor Page Anti CNNM1 pAb (ATL-HPA040408)