Anti CNNM1 pAb (ATL-HPA040408)

Atlas Antibodies

Catalog No.: ATL-HPA040408-25

Protein Description: cyclin and CBS domain divalent metal cation transport mediator 1
Gene Name: CNNM1
Alternative Gene Name: ACDP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025189: 86%, ENSRNOG00000016302: 86%
Entrez Gene ID: 26507
Uniprot ID: Q9NRU3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: TACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLT
• Gene Sequence: TACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSLPCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLT
• Gene ID - Mouse: ENSMUSG00000025189
• Gene ID - Rat: ENSRNOG00000016302
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.