Anti CNN3 pAb (ATL-HPA051237 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA051237-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: calponin 3, acidic
Gene Name: CNN3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000053931: 93%, ENSRNOG00000011559: 92%
Entrez Gene ID: 1266
Uniprot ID: Q15417
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
Gene Sequence PKYCAAPTEPVIHNGSQGTGTNGSEISDSDYQAEYPDEYHGEYQDDYPRDYQYSDQGIDY
Gene ID - Mouse ENSMUSG00000053931
Gene ID - Rat ENSRNOG00000011559
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti CNN3 pAb (ATL-HPA051237 w/enhanced validation)
Datasheet Anti CNN3 pAb (ATL-HPA051237 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNN3 pAb (ATL-HPA051237 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti CNN3 pAb (ATL-HPA051237 w/enhanced validation)
Datasheet Anti CNN3 pAb (ATL-HPA051237 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti CNN3 pAb (ATL-HPA051237 w/enhanced validation)